-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUMO3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SUMO3 (NP_008867.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SUMO3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SUMO3 (NP_008867.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04881A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUMO3 |
| Target Synonyms | SMT3A; Smt3B; SMT3H1; SUMO-3; SUMO3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, 293T, LO2, Mouse liver, Mouse small intestine, Rat liver, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SUMO3 (NP_008867.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG | Uniprot ID | P55854 |
Uniprot Id
P55854
Target Species
Human
Target Name
SUMO3
Target Full Name
Small ubiquitin-related modifier 3
Target Function
Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. Plays a role in the regulation of sumoylation status of SETX.
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus, PML body.
Target Protein Families
Ubiquitin family, SUMO subfamily
Target Tissue Specificity
Expressed predominantly in liver.
Target Synonyms
Small ubiquitin like modifier 3; Small ubiquitin related modifier 3; Small ubiquitin-related modifier 3; SMT3 homolog 1; SMT3 suppressor of mif two 3 homolog 1; SMT3 suppressor of mif two 3 homolog 3; SMT3, yeast, homolog 1; SMT3A; Smt3B; SMT3H1; SUMO-2; SUMO-3; sumo3; SUMO3_HUMAN; Ubiquitin like protein SMT3A; Ubiquitin-like protein SMT3B
Target Background
This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described.
Notification