-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMM10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90aa of human TIMM10 (NP_000204.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TIMM10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90aa of human TIMM10 (NP_000204.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14955A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMM10 |
| Target Synonyms | TIM10; TIM10A; TIMM10A; [KD Validated] TIMM10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90aa of human TIMM10 (NP_000204.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA | Uniprot ID | P62072 |
Uniprot Id
P62072
Target Species
Human
Target Name
TIMM10
Target Full Name
Mitochondrial import inner membrane translocase subunit Tim10
Target Function
Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
Target Protein Families
Small Tim family
Target Tissue Specificity
Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle.
Target Synonyms
TIMM10; TIM10; Mitochondrial import inner membrane translocase subunit Tim10
Target Background
The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins.
Notification