-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMM10B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TIMM10B (NP_036324.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TIMM10B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TIMM10B (NP_036324.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01282A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMM10B |
| Target Synonyms | FXC1; Tim9b; TIM10B; TIMM10B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BT-474, HepG2, HT-1080 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TIMM10B (NP_036324.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS | Uniprot ID | Q9Y5J6 |
Uniprot Id
Q9Y5J6
Target Species
Human
Target Name
TIMM10B
Target Full Name
Mitochondrial import inner membrane translocase subunit Tim10 B
Target Function
Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein.
Target Protein Families
Small Tim family
Target Tissue Specificity
Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle.
Target Research Area
Signal Transduction
Target Synonyms
Fracture callus 1 homolog (rat); Fracture callus 1 homolog; Fracture callus protein 1; FxC1; Mitochondrial import inner membrane translocase subunit Tim10 B; Mitochondrial import inner membrane translocase subunit Tim9 B; OTTHUMP00000164584; OTTHUMP00000230720; TIM 10B; Tim10b; Tim9b; TIM9B_HUMAN; TIMM10B; Translocase of inner mitochondrial membrane 10 homolog B (yeast)
Target Background
FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.
Notification