Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TM9SF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 133-300 of human TM9SF3 (NP_064508.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TM9SF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 133-300 of human TM9SF3 (NP_064508.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09183A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TM9SF3 |
| Target Synonyms | SMBP; EP70-P-iso; TM9SF3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549, Jurkat, NCI-H460, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 133-300 of human TM9SF3 (NP_064508.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YIDDLPIWGIVGEADENGEDYYLWTYKKLEIGFNGNRIVDVNLTSEGKVKLVPNTKIQMSYSVKWKKSDVKFEDRFDKYLDPSFFQHRIHWFSIFNSFMMVIFLVGLVSMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLIFSSLIGSGCQ | Uniprot ID | Q9HD45 |
Uniprot Id
Q9HD45
Target Species
Human
Target Name
TM9SF3
Target Full Name
Transmembrane 9 superfamily member 3
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Nonaspanin (TM9SF) (TC 9.A.2) family
Target Synonyms
Endomembrane protein emp70 precursor isolog; EP70 P iso; EP70-P-iso; RGD1564625; RP11 34E5.1; SM 11044 binding protein; SM-11044-binding protein; SMBP; TM9S3_HUMAN; Tm9sf3; Transmembrane 9 superfamily member 3; Transmembrane 9 superfamily protein member 3; UNQ245/PRO282
Target Background
Predicted to be involved in protein localization to membrane. Predicted to be located in exocytic vesicle. Predicted to be active in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
