-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 128-296 of human TMX2 (NP_057043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TMX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 128-296 of human TMX2 (NP_057043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-06064A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMX2 |
| Target Synonyms | PIG26; CGI-31; PDIA12; NEDMCMS; TXNDC14; TMX2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, HepG2, Mouse brain, Mouse liver, Rat testis, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 128-296 of human TMX2 (NP_057043.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK | Uniprot ID | Q9Y320 |
Uniprot Id
Q9Y320
Target Species
Human
Target Name
TMX2
Target Full Name
Thioredoxin-related transmembrane protein 2
Target Function
Endoplasmic reticulum and mitochondria-associated protein that probably functions as a regulator of cellular redox state and thereby regulates protein post-translational modification, protein folding and mitochondrial activity. Indirectly regulates neuronal proliferation, migration, and organization in the developing brain.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Mitochondrion membrane.
Target Tissue Specificity
Widely expressed.
Target Research Area
Cell Biology
Target Synonyms
Cell proliferation inducing gene 26 protein; Cell proliferation-inducing gene 26 protein; CGI 31; Growth inhibiting gene 11; PDIA12; PIG26; Protein disulfide isomerase family A; member 12; Thioredoxin domain containing protein 14; Thioredoxin domain-containing protein 14; Thioredoxin related transmembrane protein 2; Thioredoxin-related transmembrane protein 2; tmx2; TMX2_HUMAN; TXNDC14
Target Background
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines.
Notification