Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSPAN6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human TSPAN6 (NP_003261.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TSPAN6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human TSPAN6 (NP_003261.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06928A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSPAN6 |
| Target Synonyms | T245; TM4SF6; TSPAN-6; TSPAN6 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-200 of human TSPAN6 (NP_003261.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIK | Uniprot ID | O43657 |
Uniprot Id
O43657
Target Species
Human
Target Name
TSPAN6
Target Full Name
Tetraspanin-6
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Tetraspanin (TM4SF) family
Target Synonyms
TSPAN6; TM4SF6; UNQ767/PRO1560; Tetraspanin-6; Tspan-6; A15 homolog; Putative NF-kappa-B-activating protein 321; T245 protein; Tetraspanin TM4-D; Transmembrane 4 superfamily member 6
Target Background
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The protein encoded by this gene is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2 protein. It functions as a negative regulator of retinoic acid-inducible gene I-like receptor-mediated immune signaling via its interaction with the mitochondrial antiviral signaling-centered signalosome. This gene uses alternative polyadenylation sites, and multiple transcript variants result from alternative splicing.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
