Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBAC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human UBAC2 (NP_001137544.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBAC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human UBAC2 (NP_001137544.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04701A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBAC2 |
| Target Synonyms | PHGDHL1; UBAC2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-310 of human UBAC2 (NP_001137544.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQV | Uniprot ID | Q8NBM4 |
Uniprot Id
Q8NBM4
Target Species
Human
Target Name
UBAC2
Target Full Name
Ubiquitin-associated domain-containing protein 2
Target Function
Restricts trafficking of FAF2 from the endoplasmic reticulum to lipid droplets. In association with LMBR1L and E3 ubiquitin-protein ligase AMFR, negatively regulates the canonical Wnt signaling pathway in the lymphocytes by promoting the ubiquitin-mediated degradation of CTNNB1 and Wnt receptors FZD6 and LRP6.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Synonyms
UBAC2; PHGDHL1; PSEC0110; Ubiquitin-associated domain-containing protein 2; UBA domain-containing protein 2; Phosphoglycerate dehydrogenase-like protein 1
Target Background
Involved in negative regulation of canonical Wnt signaling pathway and negative regulation of retrograde protein transport, ER to cytosol. Acts upstream of or within protein localization to endoplasmic reticulum. Located in endoplasmic reticulum.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
