-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2L3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 73-212 of human UBE2L3 (NP_001243284.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against UBE2L3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 73-212 of human UBE2L3 (NP_001243284.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03999A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2L3 |
| Target Synonyms | E2-F1; L-UBC; UBCH7; UbcM4; UBE2L3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HL-60, K-562, Mouse brain, Mouse skeletal muscle, Mouse testis, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 73-212 of human UBE2L3 (NP_001243284.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD | Uniprot ID | P68036 |
Uniprot Id
P68036
Target Species
Human
Target Name
UBE2L3
Target Full Name
Ubiquitin-conjugating enzyme E2 L3
Target Function
Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PRKN and ARIH1, that function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-lived and abnormal proteins. Down-regulated during the S-phase it is involved in progression through the cell cycle. Regulates nuclear hormone receptors transcriptional activity. May play a role in myelopoiesis.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Ubiquitous, with highest expression in testis.
Target Synonyms
E2 F1; L UBC; L-UBC; UB2L3_HUMAN; UBCE7; UbcH7; UbcM4; Ube2l3; Ubiquitin carrier protein L3; Ubiquitin conjugating enzyme E2 L3; Ubiquitin protein ligase L3; Ubiquitin-conjugating enzyme E2 L3; Ubiquitin-conjugating enzyme E2-F1; Ubiquitin-protein ligase L3
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene.
Notification