-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UIMC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human UIMC1 (NP_057374.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against UIMC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human UIMC1 (NP_057374.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10699A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UIMC1 |
| Target Synonyms | RAP80; X2HRIP110; UIMC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, MCF7, Mouse thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human UIMC1 (NP_057374.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDS | Uniprot ID | Q96RL1 |
Uniprot Id
Q96RL1
Target Species
Human
Target Name
UIMC1
Target Full Name
BRCA1-A complex subunit RAP80
Target Function
Ubiquitin-binding protein. Specifically recognizes and binds 'Lys-63'-linked ubiquitin. Plays a central role in the BRCA1-A complex by specifically binding 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. Also weakly binds monoubiquitin but with much less affinity than 'Lys-63'-linked ubiquitin. May interact with monoubiquitinated histones H2A and H2B; the relevance of such results is however unclear in vivo. Does not bind Lys-48'-linked ubiquitin. May indirectly act as a transcriptional repressor by inhibiting the interaction of NR6A1 with the corepressor NCOR1.
Target Subcellular Location
Nucleus. Note=Localizes at sites of DNA damage at double-strand breaks (DSBs).
Target Protein Families
RAP80 family
Target Tissue Specificity
Expressed in testis, ovary, thymus and heart. Expressed in germ cells of the testis.
Target Synonyms
BRCA1-A complex subunit RAP80; Nuclear zinc finger protein RAP80; OTTHUMP00000161441; OTTHUMP00000223372; OTTHUMP00000223374; RAP80; Receptor associated protein 80; Receptor-associated protein 80; Retinoid X receptor interacting protein 110; Retinoid x receptor interacting protein; Retinoid X receptor-interacting protein 110; RIP110; Rxrip110; Ubiquitin interaction motif containing 1; Ubiquitin interaction motif containing protein 1; Ubiquitin interaction motif-containing protein 1; UIMC1; UIMC1_HUMAN; X2HRIP110
Target Background
This gene encodes a nuclear protein that interacts with Brca1 (breast cancer 1) in a complex to recognize and repair DNA lesions. This protein binds ubiquitinated lysine 63 of histone H2A and H2AX. This protein may also function as a repressor of transcription. Alternative splicing results in multiple transcript variants.
Notification