Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UMPS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human UMPS (NP_000364.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against UMPS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human UMPS (NP_000364.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03549A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UMPS |
| Target Synonyms | OPRT; UMPS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HT-29, LO2, Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human UMPS (NP_000364.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADV | Uniprot ID | P11172 |
Uniprot Id
P11172
Target Species
Human
Target Name
UMPS
Target Full Name
Uridine 5'-monophosphate synthase
Target Involvement
Orotic aciduria 1 (ORAC1)
Target Protein Families
Purine/pyrimidine phosphoribosyltransferase family; OMP decarboxylase family
Target Synonyms
OPRT; UMPS
Target Background
This gene encodes a uridine 5'-monophosphate synthase. The encoded protein is a bifunctional enzyme that catalyzes the final two steps of the de novo pyrimidine biosynthetic pathway. The first reaction is carried out by the N-terminal enzyme orotate phosphoribosyltransferase which converts orotic acid to orotidine-5'-monophosphate. The terminal reaction is carried out by the C-terminal enzyme OMP decarboxylase which converts orotidine-5'-monophosphate to uridine monophosphate. Defects in this gene are the cause of hereditary orotic aciduria. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
