-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UNC93B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human UNC93B1 (NP_112192.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UNC93B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human UNC93B1 (NP_112192.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10121A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UNC93B1 |
| Target Synonyms | IIAE1; UNC93; UNC93B; Unc-93B1; UNC93B1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, Mouse lung, Mouse spleen, Rat kidney, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human UNC93B1 (NP_112192.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDES | Uniprot ID | Q9H1C4 |
Uniprot Id
Q9H1C4
Target Species
Human
Target Name
UNC93B1
Target Full Name
Protein unc-93 homolog B1
Target Function
Plays an important role in innate and adaptive immunity by regulating nucleotide-sensing Toll-like receptor (TLR) signaling. Required for the transport of a subset of TLRs (including TLR3, TLR7 and TLR9) from the endoplasmic reticulum to endolysosomes where they can engage pathogen nucleotides and activate signaling cascades. May play a role in autoreactive B-cells removal.
Target Involvement
Herpes simplex encephalitis 1 (HSE1)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endosome. Lysosome. Cytoplasmic vesicle, phagosome.
Target Protein Families
Unc-93 family
Target Tissue Specificity
Expressed in plasmocytoid dendritic cells (at protein level). Highly expressed in antigen-presenting cells. Expressed in heart, and at lower level in kidney. Expressed at low level in other tissues.
Target Synonyms
UNC93B1; UNC93; UNC93B; Protein unc-93 homolog B1; Unc-93B1; hUNC93B1
Target Background
This gene encodes a protein that is involved in innate and adaptive immune response by regulating toll-like receptor signaling. The encoded protein traffics nucleotide sensing toll-like receptors to the endolysosome from the endoplasmic reticulum. Deficiency of the encoded protein has been associated with herpes simplex encephalitis.
Notification