-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UPF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1153-1272 of human UPF2 (NP_542166.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against UPF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1153-1272 of human UPF2 (NP_542166.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-02690A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UPF2 |
| Target Synonyms | HUPF2; RENT2; smg-3; UPF2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1153-1272 of human UPF2 (NP_542166.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGGRRR | Uniprot ID | Q9HAU5 |
Uniprot Id
Q9HAU5
Target Species
Human
Target Name
UPF2
Target Full Name
Regulator of nonsense transcripts 2
Target Function
Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC). Recruited by UPF3B associated with the EJC core at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2-UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF3B stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA.
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
DKFZp434D222; hUpf2; KIAA1408; MGC138834; MGC138835; Nonsense mRNA reducing factor 2; Regulator of nonsense transcripts 2; RENT2; RENT2_HUMAN; Smg 3; Smg 3 homolog nonsense mediated mRNA decay factor; Up-frameshift suppressor 2 homolog; UPF2; UPF2 regulator of nonsense transcripts homolog; UROC1; Urocanate hydratase; Yeast Upf2p homolog
Target Background
This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located in the perinuclear area. It interacts with translation release factors and the proteins that are functional homologs of yeast Upf1p and Upf3p. Two splice variants have been found for this gene; both variants encode the same protein.
Notification