Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UPK3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-207 of human UPK3A (NP_008884.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against UPK3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-207 of human UPK3A (NP_008884.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01200A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UPK3A |
| Target Synonyms | UP3A; UPK3; UPIII; UPIIIA; UPK3A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HL-60, Mouse brain, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-207 of human UPK3A (NP_008884.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCNAPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGG | Uniprot ID | O75631 |
Uniprot Id
O75631
Target Species
Human
Target Name
UPK3A
Target Full Name
Uroplakin-3a
Target Function
Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence.
Target Involvement
Mutations in UPK3A have been detected in patients with renal adyplasia suggesting a possible involvement of this gene in kidney and urinary tract anomalies.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Protein Families
Uroplakin-3 family
Target Tissue Specificity
Expressed in ureter.
Target Synonyms
UPK3A; UPK3; Uroplakin-3a; UP3a; Uroplakin III; UPIII
Target Background
This gene encodes a member of the uroplakin family, a group of transmembrane proteins that form complexes on the apical surface of the bladder epithelium. Mutations in this gene may be associated with renal adysplasia. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
