-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human USP14 (NP_005142.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human USP14 (NP_005142.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00155A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP14 |
| Target Synonyms | TGT; Ubp6; USP14 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human USP14 (NP_005142.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ | Uniprot ID | P54578 |
Uniprot Id
P54578
Target Species
Human
Target Name
USP14
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 14
Target Function
Proteasome-associated deubiquitinase which releases ubiquitin from the proteasome targeted ubiquitinated proteins. Ensures the regeneration of ubiquitin at the proteasome. Is a reversibly associated subunit of the proteasome and a large fraction of proteasome-free protein exists within the cell. Required for the degradation of the chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Serves also as a physiological inhibitor of endoplasmic reticulum-associated degradation (ERAD) under the non-stressed condition by inhibiting the degradation of unfolded endoplasmic reticulum proteins via interaction with ERN1. Indispensable for synaptic development and function at neuromuscular junctions (NMJs). Plays a role in the innate immune defense against viruses by stabilizing the viral DNA sensor CGAS and thus inhibiting its autophagic degradation.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein.
Target Protein Families
Peptidase C19 family, USP14/UBP6 subfamily
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Deubiquitinating enzyme 14; TGT; tRNA guanine transglycosylase 60 kD subunit; tRNA guanine transglycosylase; Ubiquitin carboxyl terminal hydrolase 14; Ubiquitin carboxyl-terminal hydrolase 14; Ubiquitin specific peptidase 14; Ubiquitin specific processing protease 14; Ubiquitin specific protease 14; Ubiquitin thiolesterase 14; Ubiquitin-specific-processing protease 14; UBP14_HUMAN; USP 14; USP14
Target Background
This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Notification