-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 852-952 of human USP15 (NP_006304.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against USP15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 852-952 of human USP15 (NP_006304.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02841A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP15 |
| Target Synonyms | UNPH4; UNPH-2; USP15 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 852-952 of human USP15 (NP_006304.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDIENENCMHTN | Uniprot ID | Q9Y4E8 |
Uniprot Id
Q9Y4E8
Target Species
Human
Target Name
USP15
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 15
Target Function
Hydrolase that removes conjugated ubiquitin from target proteins and regulates various pathways such as the TGF-beta receptor signaling, NF-kappa-B and RNF41/NRDP1-PRKN pathways. Acts as a key regulator of TGF-beta receptor signaling pathway, but the precise mechanism is still unclear: according to a report, acts by promoting deubiquitination of monoubiquitinated R-SMADs (SMAD1, SMAD2 and/or SMAD3), thereby alleviating inhibition of R-SMADs and promoting activation of TGF-beta target genes. According to another reports, regulates the TGF-beta receptor signaling pathway by mediating deubiquitination and stabilization of TGFBR1, leading to an enhanced TGF-beta signal. Able to mediate deubiquitination of monoubiquitinated substrates, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May also regulate gene expression and/or DNA repair through the deubiquitination of histone H2B. Acts as an inhibitor of mitophagy by counteracting the action of parkin (PRKN): hydrolyzes cleavage of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains attached by parkin on target proteins such as MFN2, thereby reducing parkin's ability to drive mitophagy. Acts as an associated component of COP9 signalosome complex (CSN) and regulates different pathways via this association: regulates NF-kappa-B by mediating deubiquitination of NFKBIA and deubiquitinates substrates bound to VCP. Involved in endosome organization by mediating deubiquitination of SQSTM1: ubiquitinated SQSTM1 forms a molecular bridge that restrains cognate vesicles in the perinuclear region and its deubiquitination releases target vesicles for fast transport into the cell periphery. Acts as a negative regulator of antifungal immunity by mediating 'Lys-27'-linked deubiquitination of CARD9, thereby inactivating CARD9.; (Microbial infection) Protects APC and human papillomavirus type 16 protein E6 against degradation via the ubiquitin proteasome pathway.
Target Subcellular Location
Cytoplasm. Nucleus. Mitochondrion.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Expressed in skeletal muscle, kidney, heart, placenta, liver, thymus, lung, and ovary, with little or no expression in other tissues.
Target Synonyms
Deubiquitinating enzyme 15; Deubiquitinating enzyme; EC 3 1 2 15; KIAA0529; MGC131982; MGC149838; MGC74854; Ubiquitin Carboxy terminal Hydrolase 15; Ubiquitin carboxyl-terminal hydrolase 15; Ubiquitin specific peptidase 15; Ubiquitin specific processing protease 15; Ubiquitin Specific Protease 15; Ubiquitin thioesterase 15; Ubiquitin thiolesterase 15; Ubiquitin-specific-processing protease 15; UBP 15; UBP15; UBP15_HUMAN; Unph 2; UNPH 4; Unph-2; Unph2; Unph4; USP 15; Usp15
Target Background
This gene encodes a member of the ubiquitin specific protease (USP) family of deubiquitinating enzymes. USP enzymes play critical roles in ubiquitin-dependent processes through polyubiquitin chain disassembly and hydrolysis of ubiquitin-substrate bonds. The encoded protein associates with the COP9 signalosome, and also plays a role in transforming growth factor beta signalling through deubiquitination of receptor-activated SMAD transcription factors. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 2.
Notification