-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human USP22 (Q9UPT9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human USP22 (Q9UPT9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14049A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP22 |
| Target Synonyms | USP3L; USP22 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human USP22 (Q9UPT9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKSCICHVCGVHLNRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGL | Uniprot ID | Q9UPT9 |
Uniprot Id
Q9UPT9
Target Species
Human
Target Name
USP22
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 22
Target Function
Histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. Recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation and cell cycle progression.
Target Subcellular Location
Nucleus.
Target Protein Families
Peptidase C19 family, UBP8 subfamily
Target Tissue Specificity
Moderately expressed in various tissues including heart and skeletal muscle, and weakly expressed in lung and liver.
Target Synonyms
Deubiquitinating enzyme 22; KIAA1063; Ubiquitin carboxyl terminal hydrolase 22; Ubiquitin carboxyl-terminal hydrolase 22; Ubiquitin specific peptidase 22; Ubiquitin specific peptidase 3 like; Ubiquitin specific processing protease 22; Ubiquitin specific protease 22; Ubiquitin thioesterase 22; Ubiquitin thiolesterase 22; Ubiquitin-specific-processing protease 22; UBP22_HUMAN; USP 22; Usp22; USP3L
Target Background
Enables enzyme binding activity; nuclear receptor coactivator activity; and thiol-dependent deubiquitinase. Contributes to H4 histone acetyltransferase activity. Involved in positive regulation of mitotic cell cycle; positive regulation of transcription, DNA-templated; and protein modification by small protein conjugation or removal. Part of SAGA complex.
Notification