Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP24 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2500-2600 of human USP24 (Q9UPU5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP24 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2500-2600 of human USP24 (Q9UPU5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13226A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP24 |
| Target Synonyms | USP24; ubiquitin specific peptidase 24 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2500-2600 of human USP24 (Q9UPU5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSGSSNGSESSPANENGDRHLQQ | Uniprot ID | Q9UPU5 |
Uniprot Id
Q9UPU5
Target Species
Human
Target Name
USP24
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 24
Target Function
Ubiquitin-specific protease that regulates cell survival in various contexts through modulating the protein stability of some of its substrates including DDB2, MCL1 or TP53. Plays a positive role on ferritinophagy where ferritin is degraded in lysosomes and releases free iron.
Target Protein Families
Peptidase C19 family
Target Synonyms
Deubiquitinating enzyme 24; KIAA1057; Ubiquitin carboxyl terminal hydrolase 24; Ubiquitin carboxyl-terminal hydrolase 24; Ubiquitin specific peptidase 24; Ubiquitin specific processing protease 24; Ubiquitin specific protease 24; Ubiquitin thioesterase 24; Ubiquitin thiolesterase 24; Ubiquitin-specific-processing protease 24; UBP24_HUMAN; Usp24
Target Background
Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP24 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
