Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against USP40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1173-1247 of human USP40 (NP_060688.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against USP40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1173-1247 of human USP40 (NP_060688.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04785A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | USP40 |
| Target Synonyms | USP40 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse pancreas, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1173-1247 of human USP40 (NP_060688.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GDTIGVKNLLIDDDDDFSTIRDDTGKEKQKQRALGRRKSQEALHEQSSYILSSAETPARPRAPETSLSIHVGSFR | Uniprot ID | Q9NVE5 |
Uniprot Id
Q9NVE5
Target Species
Human
Target Name
USP40
Target Full Name
Ubiquitin carboxyl-terminal hydrolase 40
Target Function
May be catalytically inactive.
Target Protein Families
Peptidase C19 family
Target Tissue Specificity
Broadly expressed.
Target Synonyms
Deubiquitinating enzyme 40; Ubiquitin carboxyl-terminal hydrolase 40; Ubiquitin thiolesterase 40; Ubiquitin-specific-processing protease 40; UBP40_HUMAN; Usp40
Target Background
Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP40 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
