-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against VPS35 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human VPS35 (Q96QK1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against VPS35 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human VPS35 (Q96QK1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14035A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | VPS35 |
| Target Synonyms | MEM3; PARK17; VPS35 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, A549, Jurkat, Mouse brain, Mouse liver, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human VPS35 (Q96QK1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQ | Uniprot ID | Q96QK1 |
Uniprot Id
Q96QK1
Target Species
Human
Target Name
VPS35
Target Full Name
Vacuolar protein sorting-associated protein 35
Target Function
Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The CSC seems to associate with the cytoplasmic domain of cargo proteins predominantly via VPS35; however, these interactions seem to be of low affinity and retromer SNX proteins may also contribute to cargo selectivity thus questioning the classical function of the CSC. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde endosome-to-TGN transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5. Required for retrograde transport of lysosomal enzyme receptor IGF2R and SLC11A2. Required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Required for endosomal localization of WASHC2C. Mediates the association of the CSC with the WASH complex via WASHC2. Required for the endosomal localization of TBC1D5.; (Microbial infection) The heterotrimeric retromer cargo-selective complex (CSC) mediates the exit of human papillomavirus from the early endosome and the delivery to the Golgi apparatus.
Target Involvement
Parkinson disease 17 (PARK17)
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein. Endosome. Early endosome. Late endosome.
Target Protein Families
VPS35 family
Target Tissue Specificity
Ubiquitous. Highly expressed in heart, brain, placenta, skeletal muscle, spleen, thymus, testis, ovary, small intestine, kidney and colon.
Target Research Area
Signal Transduction
Target Synonyms
DKFZp434E1211; DKFZp434P1672; FLJ10752; FLJ13588; FLJ20388; hVPS35; Maternal embryonic 3; Maternal-embryonic 3; MEM 3; MEM3; PARK17; TCCCTA00141; Vacuolar protein sorting 35 (yeast); Vacuolar protein sorting 35; Vacuolar protein sorting 35 homolog; Vacuolar protein sorting associated protein 35; Vacuolar protein sorting-associated protein 35; Vesicle protein sorting 35; VPS 35; VPS35; VPS35_HUMAN
Target Background
This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex.
Notification