-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WNK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human WNK3 (NP_065973.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against WNK3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human WNK3 (NP_065973.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05003A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WNK3 |
| Target Synonyms | PRKWNK3; WNK3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HAP1 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human WNK3 (NP_065973.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMV | Uniprot ID | Q9BYP7 |
Uniprot Id
Q9BYP7
Target Species
Human
Target Name
WNK3
Target Full Name
Serine/threonine-protein kinase WNK3
Target Function
Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Phosphorylates WNK4. Regulates the phosphorylation of SLC12A1 and SLC12A2. Increases Ca(2+) influx mediated by TRPV5 and TRPV6 by enhancing their membrane expression level via a kinase-dependent pathway. Inhibits the activity of KCNJ1 by decreasing its expression at the cell membrane in a non-catalytic manner.; Isoform 1, isoform 2, isoform 3 and isoform 4 stimulate the activity of SLC12A1, SLC12A2 and SLC12A3 and inhibit the activity of SLC12A4, SLC12A5, SLC12A6 and SLC12A7. According to PubMed:19470686, isoform 1 inhibits the activity of SLC12A3.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, WNK subfamily
Target Tissue Specificity
Expressed in brain, lung, kidney, liver and pancreas, and in fetal tissues including placenta, fetal brain, lung and kidney. Very low levels of expression were also detected in fetal heart, thymus, liver and spleen. Isoform 1 is brain-specific. Isoform 3
Target Synonyms
KIAA1566; PRKWNK 3; PRKWNK3; Protein kinase lysine deficient 3; Protein kinase lysine-deficient 3; Protein kinase with no lysine 3; Serine/threonine protein kinase WNK3; Serine/threonine-protein kinase WNK3; WNK 3; WNK lysine deficient protein kinase 3; Wnk3; WNK3_HUMAN
Target Background
This gene encodes a protein belonging to the 'with no lysine' family of serine-threonine protein kinases. These family members lack the catalytic lysine in subdomain II, and instead have a conserved lysine in subdomain I. This family member functions as a positive regulator of the transcellular Ca2+ transport pathway, and it plays a role in the increase of cell survival in a caspase-3-dependent pathway. Alternative splicing results in multiple transcript variants.
Notification