Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD53 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 107-181 of mouse CD53 (NP_031677.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD53 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 107-181 of mouse CD53 (NP_031677.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse spleen, using CD53 Rabbit pAb at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-08189A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD53 |
| Target Synonyms | Ox-44; Tspan25; CD53 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 107-181 of mouse CD53 (NP_031677.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN | Uniprot ID | Q61451 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
