-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPY was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-97 of NPY (NP_000896.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NPY was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-97 of NPY (NP_000896.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12338A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPY |
| Target Synonyms | PYY4; NPY | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-97 of NPY (NP_000896.1). | Immunogen Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW |
|---|---|---|---|
| Uniprot ID | P01303 |
Uniprot Id
P01303
Target Species
Human
Target Name
NPY
Target Full Name
Pro-neuropeptide Y
Target Function
NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Target Subcellular Location
Secreted. Cytoplasmic vesicle, secretory vesicle, neuronal dense core vesicle.
Target Protein Families
NPY family
Target Tissue Specificity
One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Target Synonyms
C-flanking peptide of NPY; CPON; Neuropeptide tyrosine; Neuropeptide Y precursor; NPY; NPY_HUMAN; Pro neuropeptide Y; PYY 4; PYY4; Y Neuropeptide
Target Background
This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.
Notification