Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PI3 Kinase p85 alpha/beta/gamma was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PI3 Kinase p85 alpha/beta/gamma was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10657A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PI3 Kinase p85 alpha/beta/gamma |
| Target Synonyms | PIK3R1/PIK3R2/PIK3R3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1). | Immunogen Sequence | SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT |
|---|---|---|---|
| Uniprot ID | P27986, O00459, Q92569 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
