Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against YUCCA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 71-221 of arabidopsis thaliana YUCCA1 (NP_194980.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against YUCCA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 71-221 of arabidopsis thaliana YUCCA1 (NP_194980.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04497A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | YUCCA1 |
| Target Synonyms | L23H3.20; L23H3_20; YUC; YUCCA; YUCCA 1; YUCCA1 | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Before inflorescence, Inflorescences, Rosette leaf | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 71-221 of arabidopsis thaliana YUCCA1 (NP_194980.1). | Immunogen Sequence | KHFCRLPLLDFPEYYPKYPSKNEFLAYLESYASHFRIAPRFNKNVQNAAYDSSSGFWRVKTHDNTEYLSKWLIVATGENADPYFPEIPGRKKFSGGKIVHASEYKSGEEFRRQKVLVVGCGNSGMEISLDLVRHNASPHLVVRNTVHVLPR |
|---|---|---|---|
| Uniprot ID | Q9SZY8 |
Uniprot Id
Q9SZY8
Target Synonyms
L23H3.20; L23H3_20; YUC; YUCCA; YUCCA 1; YUCCA1
Target Background
Mutant has elevated levels of free IAA in dominant mutant allele; Flavin Monooxygenase-Like Enzyme; Auxin Biosynthesis
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
