-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LATS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human LATS2 (NP_055387.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LATS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human LATS2 (NP_055387.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11527A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | lats2 |
| Target Synonyms | KPM; LATS2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat kidney, Rat lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human LATS2 (NP_055387.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMGYLDPR | Uniprot ID | Q9NRM7 |
Uniprot Id
Q9NRM7
Target Species
Human
Target Name
LATS2
Target Full Name
Serine/threonine-protein kinase LATS2
Target Function
Negative regulator of YAP1 in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Acts as a tumor suppressor which plays a critical role in centrosome duplication, maintenance of mitotic fidelity and genomic stability. Negatively regulates G1/S transition by down-regulating cyclin E/CDK2 kinase activity. Negative regulator of the androgen receptor. Phosphorylates SNAI1 in the nucleus leading to its nuclear retention and stabilization, which enhances its epithelial-mesenchymal transition and tumor cell invasion/migration activities. This tumor-promoting activity is independent of its effects upon YAP1 or WWTR1/TAZ.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm. Cytoplasm, cytoskeleton, spindle pole. Nucleus. Note=Colocalizes with AURKA at the centrosomes during interphase, early prophase and cytokinesis. Migrates to the spindle poles during mitosis, and to the midbody during cytokinesis. Translocates to the nucleus upon mitotic stress by nocodazole treatment.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family
Target Tissue Specificity
Expressed at high levels in heart and skeletal muscle and at lower levels in all other tissues examined.
Target Synonyms
FLJ13161; Kinase phosphorylated during mitosis protein; KPM; Large tumor suppressor homolog 2; Large tumor suppressor homolog 2 Drosophila; Large tumor suppressor kinase 2; LATS large tumor suppressor Drosophila homolog 2; LATS large tumor suppressor homolog 2; Lats2; LATS2_HUMAN; Serine/threonine kinase kpm; Serine/threonine protein kinase kpm; Serine/threonine-protein kinase kpm; Serine/threonine-protein kinase LATS2; Warts like kinase ; Warts-like kinase
Target Background
This gene encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is required for accumulation of gamma-tubulin and spindle formation at the onset of mitosis. It also interacts with a negative regulator of p53 and may function in a positive feedback loop with p53 that responds to cytoskeleton damage. Additionally, it can function as a co-repressor of androgen-responsive gene expression.
Notification