Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AQP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-295 of human AQP9 (NP_066190.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against AQP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 211-295 of human AQP9 (NP_066190.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of?AQP9 in paraffin-embedded?human liver cancer tissue using?AQP9 Rabbit pAb at a dilution of 1:100 (40x lens).?High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Cat.No | ADA-12286A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AQP9 |
| Target Synonyms | SSC1; AQP-9; T17287; HsT17287; AQP9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 211-295 of human AQP9 (NP_066190.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM | Uniprot ID | O43315 |
Uniprot Id
O43315
Target Species
Human
Target Name
AQP9
Target Full Name
Aquaporin-9
Target Function
Forms a water channel with a broad specificity. Also permeable glycerol and urea. Mediates passage of a wide variety of small, non-charged solutes including carbamides, polyols, purines, and pyrimidines.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
MIP/aquaporin (TC 1.A.8) family
Target Tissue Specificity
Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen.
Target Synonyms
AQP9; SSC1; Aquaporin-9; AQP-9; Aquaglyceroporin-9; Small solute channel 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
