-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD71/Transferrin Receptor was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human CD71/Transferrin Receptor (NP_001121620.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CD71/Transferrin Receptor was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human CD71/Transferrin Receptor (NP_001121620.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13109A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD71/Transferrin Receptor |
| Target Synonyms | T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46; CD71/Transferrin Receptor | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human CD71/Transferrin Receptor (NP_001121620.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF | Uniprot ID | P02786 |
Uniprot Id
P02786
Target Species
Human
Target Name
TFRC
Target Full Name
Transferrin receptor protein 1
Target Function
Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system. A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site. Positively regulates T and B cell proliferation through iron uptake. Acts as a lipid sensor that regulates mitochondrial fusion by regulating activation of the JNK pathway. When dietary levels of stearate (C18:0) are low, promotes activation of the JNK pathway, resulting in HUWE1-mediated ubiquitination and subsequent degradation of the mitofusin MFN2 and inhibition of mitochondrial fusion. When dietary levels of stearate (C18:0) are high, TFRC stearoylation inhibits activation of the JNK pathway and thus degradation of the mitofusin MFN2.; (Microbial infection) Acts as a receptor for new-world arenaviruses: Guanarito, Junin and Machupo virus.
Target Involvement
Immunodeficiency 46 (IMD46)
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein. Melanosome.; [Transferrin receptor protein 1, serum form]: Secreted.
Target Protein Families
Peptidase M28 family, M28B subfamily
Target Synonyms
T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46; CD71/Transferrin Receptor
Target Background
This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.
Notification