Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DPP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 638-737 of human DPP3 (Q9NY33) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DPP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 638-737 of human DPP3 (Q9NY33) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13257A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DPP3 |
| Target Synonyms | DPPIII; DPP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, A-431, HCT116, HT-29, Mouse large intestine, Rat liver, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 638-737 of human DPP3 (Q9NY33). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA | Uniprot ID | Q9NY33 |
Uniprot Id
Q9NY33
Target Species
Human
Target Name
DPP3
Target Full Name
Dipeptidyl peptidase 3
Target Function
Cleaves and degrades bioactive peptides, including angiotensin, Leu-enkephalin and Met-enkephalin. Also cleaves Arg-Arg-beta-naphthylamide (in vitro).
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Peptidase M49 family
Target Tissue Specificity
Detected in placenta (at protein level). Detected in erythrocytes (at protein level).
Target Synonyms
Dipeptidyl aminopeptidase III; Dipeptidyl arylamidase III; Dipeptidyl peptidase 3; Dipeptidyl peptidase III; DPP III; dpp3; DPP3_HUMAN; DPPIII; EC 3.4.14.4
Target Background
This gene encodes a protein that is a member of the M49 family of metallopeptidases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers. Alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
