-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GCET2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human GCET2 (Q8N6F7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GCET2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human GCET2 (Q8N6F7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13396A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GCET2 |
| Target Synonyms | HGAL; GCAT2; GCET2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Raji, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human GCET2 (Q8N6F7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL | Uniprot ID | Q8N6F7 |
Uniprot Id
Q8N6F7
Target Species
Human
Target Name
GCSAM
Target Full Name
Germinal center-associated signaling and motility protein
Target Function
Involved in the negative regulation of lymphocyte motility. It mediates the migration-inhibitory effects of IL6. Serves as a positive regulator of the RhoA signaling pathway. Enhancement of RhoA activation results in inhibition of lymphocyte and lymphoma cell motility by activation of its downstream effector ROCK. Is a regulator of B-cell receptor signaling, that acts through SYK kinase activation.
Target Subcellular Location
Cytoplasm. Cell membrane. Note=It relocalizes from the cytoplasm to podosome-like structures upon cell treatment with IL6.
Target Tissue Specificity
Expressed in diffuse large B-cell lymphoma (DLBCL) and several germinal center (GC)-like lymphoma cell lines (at protein level). Highly expressed in normal GC lymphocytes and GC-derived malignancies. Expressed in thymus and spleen.
Target Synonyms
GCAT2; Gcet; GCET2 germinal center expressed transcript 2; GCET2 germinal centre expressed transcript 2; Gcsam; GCSAM_HUMAN; Germinal center associated lymphoma ; Germinal center associated lymphoma protein; Germinal center B cell associated protein 2; Germinal center B-cell-expressed transcript 2 protein; Germinal center expressed transcript 2; Germinal center-associated lymphoma protein; Germinal center-associated signaling and motility protein; Germinal centre associated lymphoma ; Germinal centre associated lymphoma protein; Germinal centre B cell associated protein 2; Germinal centre expressed transcript 2; hGAL; M17; M17 L
Target Background
This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification