-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDZK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 420-519 of human PDZK1 (Q5T2W1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against PDZK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 420-519 of human PDZK1 (Q5T2W1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-13443A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDZK1 |
| Target Synonyms | CAP70; CLAMP; PDZD1; NHERF3; NHERF-3; PDZK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 420-519 of human PDZK1 (Q5T2W1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSLADPLDTPPDSKEGIVVESNHDSHMAKERAHSTASHSSSNSEDTEM | Uniprot ID | Q5T2W1 |
Uniprot Id
Q5T2W1
Target Species
Human
Target Name
PDZK1
Target Full Name
Na(+)/H(+) exchange regulatory cofactor NHE-RF3
Target Function
A scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. May be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. May play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. May potentiate the CFTR chloride channel activity. Required for normal cell-surface expression of SCARB1. Plays a role in maintaining normal plasma cholesterol levels via its effects on SCARB1. Plays a role in the normal localization and function of the chloride-anion exchanger SLC26A6 to the plasma membrane in the brush border of the proximal tubule of the kidney. May be involved in the regulation of proximal tubular Na(+)-dependent inorganic phosphate cotransport therefore playing an important role in tubule function.
Target Subcellular Location
Membrane; Peripheral membrane protein. Cell membrane.
Target Protein Families
NHER family
Target Tissue Specificity
Expression is limited to epithelial cells. Expressed in the kidney (brush border of proximal tubule), pancreas, liver, and small intestine. Expressed at a lower level in the adrenal cortex, testis and stomach. Overexpressed in breast, renal and lung carci
Target Research Area
Signal Transduction
Target Synonyms
1700023D20Rik; 2610507N21Rik; 4921513F16Rik; AI267131; AI314638; AL022680; C terminal linking and modulating protein; CAP70; CFTR associated protein of 70 kDa ; CFTR associated protein; 70-KD; CFTR-associated protein of 70 kDa; CLAMP; D3Ertd537e; Dietary Pi-regulated RNA-1; Diphor-1; mPDZK1; Na(+)/H(+) exchange regulatory cofactor NHE-RF3; Na(+)/H(+) exchanger regulatory factor 3; Na/Pi cotransporter C-terminal-associated protein 1; Na/Pi cotransporter C-terminal-associated protein; NaPi Cap1; NaPi-Cap1; NaPiCap1; NHERF 3; NHERF-3; NHERF3; NHRF3_HUMAN; OTTHUMP00000015572 ; PDZ domain containing 1; PDZ domain containing protein 1; PDZ domain-containing protein 1; PDZD1; PDZK1; Sodium hydrogen exchanger regulatory factor 3; Sodium-hydrogen exchanger regulatory factor 3
Target Background
This gene encodes a PDZ domain-containing scaffolding protein. PDZ domain-containing molecules bind to and mediate the subcellular localization of target proteins. The encoded protein mediates the localization of cell surface proteins and plays a critical role in cholesterol metabolism by regulating the HDL receptor, scavenger receptor class B type 1. Single nucleotide polymorphisms in this gene may be associated with metabolic syndrome, and overexpression of this gene may play a role in drug resistance of multiple myeloma. Pseudogenes of this gene are located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification