-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EDF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human EDF1 (NP_003783.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EDF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human EDF1 (NP_003783.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13459A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EDF1 |
| Target Synonyms | MBF1; EDF-1; CFAP280; F1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat brain, HepG2, Mouse brain, Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human EDF1 (NP_003783.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK | Uniprot ID | O60869 |
Uniprot Id
O60869
Target Species
Human
Target Name
EDF1
Target Full Name
Endothelial differentiation-related factor 1
Target Function
Transcriptional coactivator stimulating NR5A1 and ligand-dependent NR1H3/LXRA and PPARG transcriptional activities. Enhances the DNA-binding activity of ATF1, ATF2, CREB1 and NR5A1. Regulates nitric oxid synthase activity probably by sequestering calmodulin in the cytoplasm. May function in endothelial cells differentiation, hormone-induced cardiomyocytes hypertrophy and lipid metabolism.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Also nuclear upon binding to NR5A1 and treatment of cells with TPA or forskolin.
Target Tissue Specificity
Expressed in brain, liver, lung, kidney and heart (at protein level). Ubiquitously expressed. More abundant in heart, pancreas, liver, intestine and adipose tissues.
Target Synonyms
CAP19; EDF-1; edf1; EDF1_HUMAN; Endothelial differentiation related factor 1 ; Endothelial differentiation-related factor 1; MBF1; MGC9058; Multiprotein bridging factor 1; Multiprotein-bridging factor 1
Target Background
This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants.
Notification