-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WNK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNK1 (Q9H4A3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WNK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNK1 (Q9H4A3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13838A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WNK1 |
| Target Synonyms | KDP; PSK; p65; HSN2; HSAN2; PRKWNK1; PPP1R167; WNK1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNK1 (Q9H4A3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPL | Uniprot ID | Q9H4A3 |
Uniprot Id
Q9H4A3
Target Species
Human
Target Name
WNK1
Target Full Name
Serine/threonine-protein kinase WNK1
Target Function
Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4, SLC26A6 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition.; Dominant-negative regulator of the longer isoform 1. Does not have kinase activity, does not directly inhibit WNK4 and has no direct effect on sodium and chloride ion transport. Downregulates sodium-chloride cotransporter activity indirectly by inhibiting isoform 1, it associates with isoform 1 and attenuates its kinase activity. In kidney, may play an important role regulating sodium and potassium balance.
Target Involvement
Pseudohypoaldosteronism 2C (PHA2C); Neuropathy, hereditary sensory and autonomic, 2A (HSAN2A)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, WNK subfamily
Target Tissue Specificity
Widely expressed, with highest levels observed in the testis, heart, kidney and skeletal muscle. Isoform 3 is kidney-specific and specifically expressed in the distal convoluted tubule (DCT) and connecting tubule (CNT) of the nephron.
Target Synonyms
Erythrocyte 65 kDa protein; HSAN2; HSN2; hWNK1; KDP; KIAA0344; Kinase deficient protein; MGC163339; MGC163341; p65; PPP1R167; PRKWNK1; Prostate derived sterile 20 like kinase; Protein kinase lysine deficient 1; Protein kinase lysine-deficient 1; Protein kinase with no lysine 1; Protein phosphatase 1, regulatory subunit 167; PSK; Serine/threonine protein kinase WNK1 1; Serine/threonine protein kinase WNK1 2; Serine/threonine protein kinase WNK1; Serine/threonine-protein kinase WNK1; With no K; WNK lysine deficient protein kinase 1; WNK lysine deficient protein kinase 1 isoform; WNK1; WNK1_HUMAN
Target Background
This gene encodes a member of the WNK subfamily of serine/threonine protein kinases. The encoded protein may be a key regulator of blood pressure by controlling the transport of sodium and chloride ions. Mutations in this gene have been associated with pseudohypoaldosteronism type II and hereditary sensory neuropathy type II. Alternatively spliced transcript variants encoding different isoforms have been described but the full-length nature of all of them has yet to be determined.
Notification