-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCAMKL1/DCLK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human DCAMKL1/DCLK1 (O15075) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCAMKL1/DCLK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human DCAMKL1/DCLK1 (O15075) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13869A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCAMKL1/DCLK1 |
| Target Synonyms | CL1; DCLK; CLICK1; DCDC3A; DCAMKL1; DCAMKL1/DCLK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, Mouse brain, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human DCAMKL1/DCLK1 (O15075). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRR | Uniprot ID | O15075 |
Uniprot Id
O15075
Target Species
Human
Target Name
DCLK1
Target Full Name
Serine/threonine-protein kinase DCLK1
Target Function
Probable kinase that may be involved in a calcium-signaling pathway controlling neuronal migration in the developing brain. May also participate in functions of the mature nervous system.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Target Tissue Specificity
In fetal tissues, highly expressed in brain, detectable in lung and liver, but not in kidney. In adult tissues, expressed ubiquitously in the brain, detectable in the heart, liver, spleen, thymus, prostate, testis, ovary, small intestine and colon. The ty
Target Synonyms
Calcium/calmodulin-dependent protein kinase type I-like CPG16; CL1; CLICK1; Cpg16; DCDC3A; Dcl; Dclk; Dclk1; DCLK1_HUMAN; Doublecortin domain-containing protein 3A; Doublecortin-like and CAM kinase-like 1; Doublecortin-like kinase 1; KIAA0369; Serine/threonine-protein kinase DCAMKL1; Serine/threonine-protein kinase DCLK1
Target Background
This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.
Notification