-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSME1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PSME1(NP_006254.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PSME1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PSME1(NP_006254.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13932A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSME1 |
| Target Synonyms | PA28A; IFI5111; REGalpha; PA28alpha; HEL-S-129m; PSME1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse liver, Mouse spleen, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PSME1(NP_006254.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQ | Uniprot ID | Q06323 |
Uniprot Id
Q06323
Target Species
Human
Target Name
PSME1
Target Full Name
Proteasome activator complex subunit 1
Target Function
Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
Target Protein Families
PA28 family
Target Research Area
Cell Biology
Target Synonyms
11S regulator complex alpha subunit; 11S regulator complex subunit alpha; 29 kD MCP activator subunit; 29kD MCP activator subunit; Activator of multicatalytic protease subunit 1; IFI5111; IGUP I-5111; Interferon gamma IEF SSP 5111; Interferon gamma inducible protein 5111; Interferon gamma up regulated I 5111 protein; Interferon gamma up-regulated I-5111 protein; MGC8628; PA28a; PA28alpha; Proteasome (prosome, macropain) activator subunit 1 (PA28 alpha); Proteasome activator 28 subunit alpha; Proteasome activator complex subunit 1; Proteasome activator subunit 1; PSME1; PSME1_HUMAN; REG-alpha; REGalpha
Target Background
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Alternative splicing results in multiple transcript variants.
Notification