-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eEF1G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human eEF1G (P26641) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against eEF1G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human eEF1G (P26641) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13989A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EEF1G |
| Target Synonyms | EF1G; GIG35; eEF1G | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, HT-29, Mouse brain, Rat testis, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human eEF1G (P26641). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHH | Uniprot ID | P26641 |
Uniprot Id
P26641
Target Species
Human
Target Name
EEF1G
Target Full Name
Elongation factor 1-gamma
Target Function
Probably plays a role in anchoring the complex to other cellular components.
Target Tissue Specificity
Highly expressed in pancreatic tumor tissue and to a lesser extent in normal kidney, intestine, pancreas, stomach, lung, brain, spleen and liver.
Target Synonyms
2610301D06Rik; AA407312; eEF 1B gamma; EEF 1G; eEF-1B gamma; EEF1G; EF 1 gamma; EF 1G; EF-1-gamma; EF1 gamma; EF1G; EF1G_HUMAN; Elongation factor 1 gamma; Elongation factor 1-gamma; Eukaryotic translation elongation factor 1 gamma; GIG 35; GIG35; MGC103354; MGC114210; MGC144723; MGC144724; MGC94929; Pancreatic tumor related protein; PRO1608; Translation elongation factor eEF 1 gamma chain
Target Background
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.
Notification