-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EGR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EGR2 (NP_000390.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against EGR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EGR2 (NP_000390.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-14130A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EGR2 |
| Target Synonyms | AT591; CMT1D; CMT4E; KROX20; EGR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, SH-SY5Y | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EGR2 (NP_000390.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDP | Uniprot ID | P11161 |
Uniprot Id
P11161
Target Species
Human
Target Name
EGR2
Target Full Name
E3 SUMO-protein ligase EGR2
Target Function
Sequence-specific DNA-binding transcription factor. Plays a role in hindbrain segmentation by regulating the expression of a subset of homeobox containing genes and in Schwann cell myelination by regulating the expression of genes involved in the formation and maintenance of myelin. Binds to two EGR2-consensus sites EGR2A (5'-CTGTAGGAG-3') and EGR2B (5'-ATGTAGGTG-3') in the HOXB3 enhancer and promotes HOXB3 transcriptional activation. Binds to specific DNA sites located in the promoter region of HOXA4, HOXB2 and ERBB2. Regulates hindbrain segmentation by controlling the expression of Hox genes, such as HOXA4, HOXB3 and HOXB2, and thereby specifying odd and even rhombomeres. Promotes the expression of HOXB3 in the rhombomere r5 in the hindbrain. Regulates myelination in the peripheral nervous system after birth, possibly by regulating the expression of myelin proteins, such as MPZ, and by promoting the differentiation of Schwann cells. Involved in the development of the jaw openener musculature, probably by playing a role in its innervation through trigeminal motor neurons. May play a role in adipogenesis, possibly by regulating the expression of CEBPB.; E3 SUMO-protein ligase helping SUMO1 conjugation to its coregulators NAB1 and NAB2, whose sumoylation down-regulates EGR2 transcriptional activity.
Target Involvement
Neuropathy, congenital hypomyelinating or amyelinating (CHN); Charcot-Marie-Tooth disease 1D (CMT1D); Dejerine-Sottas syndrome (DSS)
Target Subcellular Location
Nucleus.
Target Protein Families
EGR C2H2-type zinc-finger protein family
Target Synonyms
AT591; CMT1D; CMT4E; DKFZp686J1957; E3 SUMO-protein ligase EGR2; Early growth response 2; Early growth response protein 2; EGR-2; egr2; EGR2_HUMAN; FLJ14547; KROX 20 Drosophila homolog; Krox 20 homolog Drosophila; KROX-20; Drosophila; homolog (early growth response-2); KROX20; Krox20 protein; Zinc finger protein Krox-20
Target Background
The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene.
Notification