-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKAR2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 319-418 of human PRKAR2B (P31323) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PRKAR2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 319-418 of human PRKAR2B (P31323) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14288A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKAR2B |
| Target Synonyms | PRKAR2; RII-BETA; PRKAR2B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brian | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 319-418 of human PRKAR2B (P31323). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA | Uniprot ID | P31323 |
Uniprot Id
P31323
Target Species
Human
Target Name
PRKAR2B
Target Full Name
cAMP-dependent protein kinase type II-beta regulatory subunit
Target Function
Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
Target Subcellular Location
Cytoplasm. Cell membrane. Note=Colocalizes with PJA2 in the cytoplasm and at the cell membrane.
Target Protein Families
CAMP-dependent kinase regulatory chain family
Target Tissue Specificity
Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
Target Synonyms
AI451071; AW061005; cAMP dependent protein kinase type II beta regulatory chain; cAMP dependent protein kinase type II beta regulatory subunit; cAMP-dependent protein kinase type II-beta regulatory subunit; H RG363E19.2; KAP3_HUMAN; MGC116401; Pkarb2; PRKAR 2; PRKAR2; PRKAR2B; Protein kinase cAMP dependent regulatory type II beta; RATDNA; RII beta; RII(beta); RIIbeta; WUGSC:H RG363E19.2
Target Background
cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. This subunit has been shown to interact with and suppress the transcriptional activity of the cAMP responsive element binding protein 1 (CREB1) in activated T cells. Knockout studies in mice suggest that this subunit may play an important role in regulating energy balance and adiposity. The studies also suggest that this subunit may mediate the gene induction and cataleptic behavior induced by haloperidol.
Notification