-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LGI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human LGI1 (O95970) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LGI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human LGI1 (O95970) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14378A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LGI1 |
| Target Synonyms | EPT; ETL1; ADLTE; ADPAEF; ADPEAF; IB1099; EPITEMPIN; LGI1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LGI1 (O95970). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYV | Uniprot ID | O95970 |
Uniprot Id
O95970
Target Species
Human
Target Name
LGI1
Target Full Name
Leucine-rich glioma-inactivated protein 1
Target Function
Regulates voltage-gated potassium channels assembled from KCNA1, KCNA4 and KCNAB1. It slows down channel inactivation by precluding channel closure mediated by the KCNAB1 subunit. Ligand for ADAM22 that positively regulates synaptic transmission mediated by AMPA-type glutamate receptors. Plays a role in suppressing the production of MMP1/3 through the phosphatidylinositol 3-kinase/ERK pathway. May play a role in the control of neuroblastoma cell survival.
Target Involvement
Epilepsy, familial temporal lobe, 1 (ETL1)
Target Subcellular Location
Secreted. Cell junction, synapse. Note=Isoform 1 but not isoform 2 is secreted. Isoform 1 is enriched in the Golgi apparatus while isoform 2 accumulates in the endoplasmic reticulum.
Target Tissue Specificity
Predominantly expressed in neural tissues, especially in brain. Expression is reduced in low-grade brain tumors and significantly reduced or absent in malignant gliomas. Isoform 1 is absent in the cerebellum and is detectable in the occipital cortex and h
Target Research Area
Signal Transduction
Target Synonyms
ADLTE; ADPAEF; ADPEAF; Epitempin 1; EPITEMPIN; Epitempin-1; EPT; ETL1; IB1099; leucine rich glioma inactivated 1; Leucine rich glioma-inactivated protein 1; Leucine-rich glioma-inactivated protein 1; LGI1; LGI1_HUMAN; OTTHUMP00000020121; OTTHUMP00000020122
Target Background
This gene encodes a member of the secreted leucine-rich repeat (LRR) superfamily and shares homology with members of the SLIT protein family. The encoded protein may regulate the activity of voltage-gated potassium channels and may be involved in neuronal growth regulation and cell survival. This gene is rearranged as a result of translocations in glioblastoma cell lines, and it is frequently down-regulated or rearranged in malignant gliomas. Mutations in this gene result in autosomal dominant lateral temporal epilepsy. Alternative splicing results in multiple transcript variants.
Notification