-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-135 of human TMEM43 (NP_077310.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TMEM43 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-135 of human TMEM43 (NP_077310.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14573A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM43 |
| Target Synonyms | LUMA; ARVC5; ARVD5; AUNA3; EDMD7; AUNA2; TMEM43 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Mouse lung, PC-3, Rat kidney, Rat lung, Rat testis, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-135 of human TMEM43 (NP_077310.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GMFVGLMAFLLSFYLIFTNEGRALKTATSLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEMYQWVETEESREYTE | Uniprot ID | Q9BTV4 |
Uniprot Id
Q9BTV4
Target Species
Human
Target Name
TMEM43
Target Full Name
Transmembrane protein 43
Target Function
May have an important role in maintaining nuclear envelope structure by organizing protein complexes at the inner nuclear membrane. Required for retaining emerin at the inner nuclear membrane.
Target Involvement
Arrhythmogenic right ventricular dysplasia, familial, 5 (ARVD5); Emery-Dreifuss muscular dystrophy 7, autosomal dominant (EDMD7)
Target Subcellular Location
Endoplasmic reticulum. Nucleus inner membrane; Multi-pass membrane protein.
Target Protein Families
TMEM43 family
Target Tissue Specificity
Highest expression in placenta. Also found at lower levels in heart, ovary, spleen, small intestine, thymus, prostate and testis.
Target Synonyms
TMEM43; UNQ2564/PRO6244; Transmembrane protein 43; Protein LUMA
Target Background
This gene belongs to the TMEM43 family. Defects in this gene are the cause of familial arrhythmogenic right ventricular dysplasia type 5 (ARVD5), also known as arrhythmogenic right ventricular cardiomyopathy type 5 (ARVC5). Arrhythmogenic right ventricular dysplasia is an inherited disorder, often involving both ventricles, and is characterized by ventricular tachycardia, heart failure, sudden cardiac death, and fibrofatty replacement of cardiomyocytes. This gene contains a response element for PPAR gamma (an adipogenic transcription factor), which may explain the fibrofatty replacement of the myocardium, a characteristic pathological finding in ARVC.
Notification