-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AQP5 was raised in Rabbit using a synthesized peptide derived from human AQP5 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AQP5 was raised in Rabbit using a synthesized peptide derived from human AQP5 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15204A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AQP5 |
| Target Synonyms | PPKB; AQP-5; AQP5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, NUGC-4, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthesized peptide derived from human AQP5. | Immunogen Sequence | SPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR |
|---|---|---|---|
| Uniprot ID | P55064 |
Uniprot Id
P55064
Target Species
Human
Target Name
AQP5
Target Full Name
Aquaporin-5
Target Function
Forms a water-specific channel. Plays an important role in fluid secretion in salivary glands. Required for TRPV4 activation by hypotonicity. Together with TRPV4, controls regulatory volume decrease in salivary epithelial cells. Seems to play a redundant role in water transport in the eye, lung and in sweat glands.
Target Involvement
Keratoderma, palmoplantar, Bothnian type (PPKB)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Target Protein Families
MIP/aquaporin (TC 1.A.8) family
Target Tissue Specificity
Detected in skin eccrine sweat glands, at the apical cell membrane and at intercellular canaliculi (at protein level).
Target Research Area
Transport, Signal Transduction
Target Synonyms
AQP 5; AQP-5; AQP5; AQP5_HUMAN; Aquaporin 5; Aquaporin-5
Target Background
Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13.
Notification