Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD69 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to aminoacids 64-199 of mouse CD69(NP_001028294.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
The antibody against CD69 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to aminoacids 64-199 of mouse CD69(NP_001028294.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
Flow cytometry: 1X10^6 NIH/3T3 cells (negative control, left)?and CTLL-2 cells (right) were surface-stained with CD69 Rabbit mAb or ABflo? 647 Rabbit IgG isotype control, followed by Alexa Fluor? 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
| Cat.No | ADA-15598A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD69 |
| Target Synonyms | AIM; VEA; 5830438K24Rik; CD69 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to aminoacids 64-199 of mouse CD69(NP_001028294.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | GKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR | Uniprot ID | P37217 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
