-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMA7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-248 of human PSMA7 (NP_002783.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PSMA7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-248 of human PSMA7 (NP_002783.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15609A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMA7 |
| Target Synonyms | C6; HSPC; RC6-1; XAPC7; HEL-S-276; [KD Validated] PSMA7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, caco-2, Mouse brain, U-2 OS | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-248 of human PSMA7 (NP_002783.1). | Immunogen Sequence | SGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS |
|---|---|---|---|
| Uniprot ID | O14818 |
Uniprot Id
O14818
Target Species
Human
Target Name
PSMA7
Target Full Name
Proteasome subunit alpha type-7
Target Function
Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Inhibits the transactivation function of HIF-1A under both normoxic and hypoxia-mimicking conditions. The interaction with EMAP2 increases the proteasome-mediated HIF-1A degradation under the hypoxic conditions. Plays a role in hepatitis C virus internal ribosome entry site-mediated translation. Mediates nuclear translocation of the androgen receptor (AR) and thereby enhances androgen-mediated transactivation. Promotes MAVS degradation and thereby negatively regulates MAVS-mediated innate immune response.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Peptidase T1A family
Target Research Area
Immunology
Target Synonyms
C6; HSPC; MGC3755; OTTHUMP00000031449; OTTHUMP00000031450; OTTHUMP00000031453; Proteasome (prosome macropain) subunit alpha type 7; Proteasome alpha 7 subunit; Proteasome subunit alpha 4; Proteasome subunit alpha type 7; Proteasome subunit alpha type-7; Proteasome subunit RC6 1; Proteasome subunit RC6-1; Proteasome subunit XAPC7; PSA7_HUMAN; PSMA 7; PSMA7; RC6 1; XAPC7
Target Background
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9.
Notification