-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KIF5B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF5B (NP_004512.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KIF5B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF5B (NP_004512.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15874A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KIF5B |
| Target Synonyms | KNS; KINH; KNS1; UKHC; HEL-S-61; KIF5B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat heart, 293T, HepG2, Mouse brain, Mouse lung, Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF5B (NP_004512.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLH | Uniprot ID | P33176 |
Uniprot Id
P33176
Target Species
Human
Target Name
KIF5B
Target Full Name
Kinesin-1 heavy chain
Target Function
Microtubule-dependent motor required for normal distribution of mitochondria and lysosomes. Can induce formation of neurite-like membrane protrusions in non-neuronal cells in a ZFYVE27-dependent manner. Regulates centrosome and nuclear positioning during mitotic entry. During the G2 phase of the cell cycle in a BICD2-dependent manner, antagonizes dynein function and drives the separation of nuclei and centrosomes. Required for anterograde axonal transportation of MAPK8IP3/JIP3 which is essential for MAPK8IP3/JIP3 function in axon elongation. Through binding with PLEKHM2 and ARL8B, directs lysosome movement toward microtubule plus ends (Probable). Involved in NK cell-mediated cytotoxicity. Drives the polarization of cytolytic granules and microtubule-organizing centers (MTOCs) toward the immune synapse between effector NK lymphocytes and target cells.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytolytic granule membrane. Lysosome membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, Kinesin subfamily
Target Research Area
Cancer
Target Synonyms
Conventional kinesin heavy chain; KIF 5B; KIF5B; Kinesin 1 ; kinesin 1 (110-120kD); Kinesin 1 heavy chain; Kinesin family member 5B; Kinesin heavy chain; kinesin; heavy chain; ubiquitous; Kinesin-1 heavy chain; Kinesin1; KINH; KINH_HUMAN; KNS 1; KNS; KNS1; Ubiquitous kinesin heavy chain; UKHC
Target Background
Enables identical protein binding activity; microtubule binding activity; and microtubule motor activity. Involved in several processes, including lysosome localization; natural killer cell mediated cytotoxicity; and positive regulation of protein localization to plasma membrane. Located in centriolar satellite; cytosol; and vesicle.
Notification