Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HDLBP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDLBP (NP_976221.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HDLBP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDLBP (NP_976221.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15882A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HDLBP |
| Target Synonyms | HBP; VGL; PRO2900; HDLBP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, 293T, Hep G2, Jurkat, Rat pancreas | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDLBP (NP_976221.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEPSGAWGNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQ | Uniprot ID | Q00341 |
Uniprot Id
Q00341
Target Species
Human
Target Name
HDLBP
Target Full Name
Vigilin
Target Function
Appears to play a role in cell sterol metabolism. It may function to protect cells from over-accumulation of cholesterol.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Research Area
Cardiovascular
Target Synonyms
HBP; HDL binding protein; HDL-binding protein; HDLBP; high density lipoprotein binding protein; high density lipoprotein binding protein (vigilin); High density lipoprotein-binding protein; PRO2900; VGL; Vigilin; VIGLN_HUMAN
Target Background
The protein encoded by this gene binds high density lipoprotein (HDL) and may function to regulate excess cholesterol levels in cells. The encoded protein also binds RNA and can induce heterochromatin formation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
