-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCM7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human MCM7 (P33993) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against MCM7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human MCM7 (P33993) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-16005A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCM7 |
| Target Synonyms | MCM2; CDC47; P85MCM; P1CDC47; PNAS146; PPP1R104; P1.1-MCM3; MCM7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, U-87MG | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MCM7 (P33993). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDE | Uniprot ID | P33993 |
Uniprot Id
P33993
Target Species
Human
Target Name
MCM7
Target Full Name
DNA replication licensing factor MCM7
Target Function
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
MCM family
Target Synonyms
CDABP0042; CDC 47; CDC47; CDC47 homolog; Cdc47; S. cerevisiae; homolog of; DNA replication licensing factor MCM7; Homolog of S. cerevisiae Cdc47; MCM 2; MCM 7; MCM2; MCM2; formerly; Mcm7; MCM7 minichromosome maintenance deficient 7; MCM7_HUMAN; Minichromosome Maintainence 7; Minichromosome maintainence; S. cerevisiae; homolog of; Minichromosome maintenance complex component 7; Minichromosome maintenance deficient 7; Minichromosome maintenance protein 7; P1.1 MCM3; P1.1-MCM3; P1CDC47; P85MCM; PNAS 146; PNAS146; PPP1R104; Protein phosphatase 1; regulatory subunit 104
Target Background
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Notification