Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACSS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ACSS2 (Q9NR19) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ACSS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ACSS2 (Q9NR19) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16173A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Acss2 |
| Target Synonyms | ACS; ACSA; ACAS2; ACECS; AceCS1; dJ1161H23.1; ACSS2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Hep G2, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ACSS2 (Q9NR19). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSN | Uniprot ID | Q9NR19 |
Uniprot Id
Q9NR19
Target Species
Human
Target Name
ACSS2
Target Full Name
Acetyl-coenzyme A synthetase, cytoplasmic
Target Function
Catalyzes the synthesis of acetyl-CoA from short-chain fatty acids. Acetate is the preferred substrate. Can also utilize propionate with a much lower affinity.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
ATP-dependent AMP-binding enzyme family
Target Synonyms
ACAS2; AceCS; Acetate CoA ligase; Acetate thiokinase; Acetate--CoA ligase; Acetyl CoA synthetase; Acetyl Coenzyme A synthetase 2 (ADP forming); Acetyl coenzyme A synthetase cytoplasmic; Acetyl-CoA synthetase; Acetyl-coenzyme A synthetase; ACS; ACSA; ACSA_HUMAN; ACSS2; Acyl activating enzyme; Acyl CoA synthetase short chain family member 2; Acyl-activating enzyme; Acyl-CoA synthetase short-chain family member 2; Cytoplasmic acetyl coenzyme A synthetase; cytoplasmic; MYH7B
Target Background
This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
