-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WDR4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human WDR4 (P57081) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against WDR4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human WDR4 (P57081) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16237A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WDR4 |
| Target Synonyms | hWH; Wuho; MIGSB; TRM82; GAMOS6; TRMT82; WDR4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, HepG2, Mouse lung, Mouse spleen, Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human WDR4 (P57081). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGS | Uniprot ID | P57081 |
Uniprot Id
P57081
Target Species
Human
Target Name
WDR4
Target Full Name
tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
Target Function
Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit. Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs. Also required for methylation of a specific subset of miRNAs, such as let-7. Independently of METTL1, also plays a role in genome stability: localizes at the DNA replication site and regulates endonucleolytic activities of FEN1.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
WD repeat TRM82 family
Target Synonyms
OTTHUMP00000109401; OTTHUMP00000109402; TRM82; tRNA (guanine N(7) ) methyltransferase subunit WDR4; tRNA (guanine-N(7)-)-methyltransferase subunit WDR4; WD repeat containing protein 4; WD repeat protein 4; WD repeat protein domain 4 protein isoform 2; WD repeat-containing protein 4; wdr4; WDR4_HUMAN
Target Background
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene.
Notification