-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rad52 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 319-418 of human Rad52 (P43351) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Rad52 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 319-418 of human Rad52 (P43351) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16617A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAD52 |
| Target Synonyms | RAD52; DNA repair protein RAD52 homolog; Rad52 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 319-418 of human Rad52 (P43351). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS | Uniprot ID | P43351 |
Uniprot Id
P43351
Target Species
Human
Target Name
RAD52
Target Full Name
DNA repair protein RAD52 homolog
Target Function
Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase.
Target Subcellular Location
Nucleus.
Target Protein Families
RAD52 family
Target Synonyms
DNA repair protein RAD52 ; DNA repair protein RAD52; DNA repair protein RAD52 homolog; RAD 52; Rad52; RAD52 homolog (S. cerevisiae) ; RAD52 homolog (S. cerevisiae); RAD52 homolog; RAD52_HUMAN; Recombination protein RAD52 ; Recombination protein RAD52; Rhabdomyosarcoma antigen MU RMS 40.23
Target Background
The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair. A pseudogene of this gene is present on chromosome 2. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Notification