-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LRP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 4400-4500 of human LRP1 (Q07954) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LRP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 4400-4500 of human LRP1 (Q07954) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17024A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LRP1 |
| Target Synonyms | APR; KPA; LRP; A2MR; CD91; APOER; LRP1A; TGFBR5; IGFBP3R; IGFBP-3R; IGFBP3R1; LRP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver, Mouse lung, Rat liver, Rat lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 4400-4500 of human LRP1 (Q07954). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPHMTGPRCEEHVFSQQQPGHIASILIPLLLLLLLVLVAGVVFWYKRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPT | Uniprot ID | Q07954 |
Uniprot Id
Q07954
Target Species
Human
Target Name
LRP1
Target Full Name
Prolow-density lipoprotein receptor-related protein 1
Target Function
Endocytic receptor involved in endocytosis and in phagocytosis of apoptotic cells. Required for early embryonic development. Involved in cellular lipid homeostasis. Involved in the plasma clearance of chylomicron remnants and activated LRPAP1 (alpha 2-macroglobulin), as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. Acts as an LRPAP1 alpha-2-macroglobulin receptor. Acts as TAU/MAPT receptor and controls the endocytosis of TAU/MAPT as well as its subsequent spread. May modulate cellular events, such as APP metabolism, kinase-dependent intracellular signaling, neuronal calcium signaling as well as neurotransmission.; (Microbial infection) Functions as a receptor for Pseudomonas aeruginosa exotoxin A.
Target Involvement
Keratosis pilaris atrophicans (KPA)
Target Subcellular Location
[Low-density lipoprotein receptor-related protein 1 85 kDa subunit]: Cell membrane; Single-pass type I membrane protein. Membrane, coated pit.; [Low-density lipoprotein receptor-related protein 1 515 kDa subunit]: Cell membrane; Peripheral membrane protein; Extracellular side. Membrane, coated pit.; [Low-density lipoprotein receptor-related protein 1 intracellular domain]: Cytoplasm. Nucleus.; Golgi outpost. Cytoplasm, cytoskeleton, microtubule organizing center.
Target Protein Families
LDLR family
Target Tissue Specificity
Most abundant in liver, brain and lung.
Target Research Area
Cancer
Target Synonyms
LRP-1;Alpha-2-macroglobulin receptor;A2MR;Apolipoprotein E receptor;APOER;CD antigen CD91;LRP-85;LRP-515;LRPICD
Target Background
This gene encodes a member of the low-density lipoprotein receptor family of proteins. The encoded preproprotein is proteolytically processed by furin to generate 515 kDa and 85 kDa subunits that form the mature receptor (PMID: 8546712). This receptor is involved in several cellular processes, including intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. In addition, the encoded protein is necessary for the alpha 2-macroglobulin-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of this gene decreases with age and has been found to be lower than controls in brain tissue from Alzheimer's disease patients.
Notification