-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOX18 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX18 (NP_060889.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SOX18 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX18 (NP_060889.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00224A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOX18 |
| Target Synonyms | HLTS; HLTRS; SOX18 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX18 (NP_060889.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQRSPPGYGAQDDPPARRDCAWAPGHGAAADTRGLAAGPAALAAPAAPASPPSPQRSPPRSPEPGRYGLSPAGRGERQAADESRIRRPMNAFMVWAKDER | Uniprot ID | P35713 |
Uniprot Id
P35713
Target Species
Human
Target Name
SOX18
Target Full Name
Transcription factor SOX-18
Target Function
Transcriptional activator that binds to the consensus sequence 5'-AACAAAG-3' in the promoter of target genes and plays an essential role in embryonic cardiovascular development and lymphangiogenesis. Activates transcription of PROX1 and other genes coding for lymphatic endothelial markers. Plays an essential role in triggering the differentiation of lymph vessels, but is not required for the maintenance of differentiated lymphatic endothelial cells. Plays an important role in postnatal angiogenesis, where it is functionally redundant with SOX17. Interaction with MEF2C enhances transcriptional activation. Besides, required for normal hair development.
Target Involvement
Hypotrichosis-lymphedema-telangiectasia syndrome (HLTS); Hypotrichosis-lymphedema-telangiectasia-renal defect syndrome (HLTRS)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Detected in heart, lung, placenta, skeletal muscle, liver, kidney, spleen, prostate, ovary, msosmall intestine and colon.
Target Synonyms
HLTS; SOX 18; Sox18; SOX18_HUMAN; SRY (sex determining region Y) box 18; SRY box 18; Transcription factor SOX 18; Transcription factor SOX-18
Target Background
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This protein plays a role in hair, blood vessel, and lymphatic vessel development. Mutations in this gene have been associated with recessive and dominant forms of hypotrichosis-lymphedema-telangiectasia.
Notification